Use Able AI chat for product recommendations

FADD Polyclonal antibody

FADD Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14906-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (4)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

MORT1, Growth-inhibiting gene 3 protein, FAS-associating death domain-containing protein, FAS-associated death domain protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHT-1080 cells, mouse pancreas tissue, A549 cells, mouse bone marrow, HeLa cells, HepG2 cells, Jurkat cells
Positive IP detected inA549 cells
Positive IHC detected inhuman lung cancer tissue, human colon tissue, human cervical cancer tissue, rat kidney tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14906-1-AP targets FADD in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, monkey, bovine, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6701

Product name: Recombinant human FADD protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-208 aa of BC000334

Sequence: MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS

Predict reactive species
Full Name Fas (TNFRSF6)-associated via death domain
Calculated Molecular Weight 23 kDa
Observed Molecular Weight 23-30 kDa
GenBank Accession NumberBC000334
Gene Symbol FADD
Gene ID (NCBI) 8772
RRIDAB_2100486
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13158
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fas-Associated protein with Death Domain (FADD), also called MORT1 or GIG3, is encoded by the FADD gene. FADD is an adaptor protein that bridges members of the tumor necrosis factor receptor superfamily, such as the Fas-receptor, to procaspases 8 and 10 to form the death-inducing signaling complex (DISC) during apoptosis. As well as its most well known role in apoptosis, FADD has also been seen to play a role in other processes including proliferation, cell cycle regulation and development. FADD has a calculated molecular mass of 23 kDa and always can be detected as 23-30 kDa (PMID: 15390286, 22864571, 17977957)

Protocols

Product Specific Protocols
IF protocol for FADD antibody 14906-1-APDownload protocol
IHC protocol for FADD antibody 14906-1-APDownload protocol
IP protocol for FADD antibody 14906-1-APDownload protocol
WB protocol for FADD antibody 14906-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Cell Res

The metabolite α-KG induces GSDMC-dependent pyroptosis through death receptor 6-activated caspase-8.

Authors - Jia-Yuan Zhang
human,mouseWB

Cell Commun Signal

Deubiquitinase USP5 regulates RIPK1 driven pyroptosis in response to myocardial ischemic reperfusion injury

Authors - Wenjing Sun
mouseWB

PLoS Biol

A unique death pathway keeps RIPK1 D325A mutant mice in check at embryonic day 10.5.

Authors - Yingying Zhang

Microbiol Res

Caspase-8 drove apoptosis of BMECs to promote neutrophil infiltration and DE205B clearance in meningitis

Authors - Xuhang Wang
humanWB

Eur J Med Chem

PKM2/PDK1 dual-targeted shikonin derivatives restore the sensitivity of EGFR-mutated NSCLC cells to gefitinib by remodeling glucose metabolism

Authors - Hongyan Lin
ratWB,IHC

Cancers (Basel)

Astragaloside IV Inhibits the Proliferation of Human Uterine Leiomyomas by Targeting IDO1

Authors - Tiantian Qiu

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Isha (Verified Customer) (12-15-2021)

Got really good bands in kidney lysates at 1:800 dilution

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:800
  • Cell Tissue Type: kidney
Loading...
||
New chat

Able

正在加载,请稍候...