Tested Applications
Positive WB detected in | A549 cells, MCF-7 cells, PC-3 cells |
Positive IHC detected in | mouse lung tissue, human oesophagus cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
19422-1-AP targets FAM103A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag13749 Product name: Recombinant human FAM103A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC003627 Sequence: MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQDNRQFRGRDNRWGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY Predict reactive species |
Full Name | family with sequence similarity 103, member A1 |
Calculated Molecular Weight | 118 aa, 14 kDa |
Observed Molecular Weight | 14 kDa |
GenBank Accession Number | BC003627 |
Gene Symbol | FAM103A1 |
Gene ID (NCBI) | 83640 |
RRID | AB_2878578 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9BTL3 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FAM103A1, also named as RNMT-activating mini protein, is a 118 amino acid protein, which belongs to the RAM family. FAM103A1 as a component of mRNA cap binding complex localizes in the nucleus. FAM103A1 is required for efficient mRNA cap methylation and regulates RNMT expression by a post-transcriptional stabilizing mechanism.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FAM103A1 antibody 19422-1-AP | Download protocol |
IHC protocol for FAM103A1 antibody 19422-1-AP | Download protocol |
IF protocol for FAM103A1 antibody 19422-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |