Tested Applications
Positive WB detected in | HEK-293 cells, HeLa cells, mouse kidney tissue, rat kidney tissue |
Positive IP detected in | HEK-293 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 2 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
IP | See 1 publications below |
Product Information
21768-1-AP targets FAM117B in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16407 Product name: Recombinant human FAM117B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 49-128 aa of BC106906 Sequence: SKHSSRHHRDKERQSPFHGNHAAINQCQAPVPKSALIPVIPITKSTGSRFRNSVEGLNQEIEIIIKETGEKEEQLIPQDI Predict reactive species |
Full Name | family with sequence similarity 117, member B |
Calculated Molecular Weight | 589 aa, 62 kDa |
Observed Molecular Weight | 66 kDa |
GenBank Accession Number | BC106906 |
Gene Symbol | FAM117B |
Gene ID (NCBI) | 150864 |
RRID | AB_10804757 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q6P1L5 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FAM117B, also named as ALS2CR13, is mapped in the genomic region covering the complete candidate region for Amyotrophic lateral sclerosis 2 (ALS2). This antibody is specific to FAM117B.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FAM117B antibody 21768-1-AP | Download protocol |
IP protocol for FAM117B antibody 21768-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Clin Invest FAM117B promotes gastric cancer growth and drug resistance by targeting the KEAP1/NRF2 signaling pathway
| ||
Cancer Res Proteomic analysis of ubiquitin ligase KEAP1 reveals associated proteins that inhibit NRF2 ubiquitination. |