Tested Applications
Positive WB detected in | HepG2 cells |
Positive IP detected in | HepG2 cells |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
25987-1-AP targets FAM120C in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag23235 Product name: Recombinant human FAM120C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 29-99 aa of BC136413 Sequence: TVSRQQQQQHLHRQLPPTAALAPGAPRAARGSVPLQPPLPPAALGAYSGGAGPTRHHHPAHHFHHHGQAQP Predict reactive species |
Full Name | family with sequence similarity 120C |
Observed Molecular Weight | 120 kDa |
GenBank Accession Number | BC136413 |
Gene Symbol | FAM120C |
Gene ID (NCBI) | 54954 |
RRID | AB_2880321 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NX05 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FAM120C antibody 25987-1-AP | Download protocol |
IF protocol for FAM120C antibody 25987-1-AP | Download protocol |
IP protocol for FAM120C antibody 25987-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |