Tested Applications
Positive IHC detected in | human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
Product Information
26726-1-AP targets EVA1A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24990 Product name: Recombinant human FAM176A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 57-108 aa of BC063016 Sequence: ISCHTDCRRRPGKKFLQDRESSSDSSDSEDGSEDTVSDLSVRRHRRFERTLN Predict reactive species |
Full Name | family with sequence similarity 176, member A |
Calculated Molecular Weight | 17 kDa |
GenBank Accession Number | BC063016 |
Gene Symbol | FAM176A |
Gene ID (NCBI) | 84141 |
RRID | AB_2880615 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9H8M9 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for EVA1A antibody 26726-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |