Published Applications
KD/KO | See 1 publications below |
WB | See 2 publications below |
Product Information
25038-1-AP targets FAM46C in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19147 Product name: Recombinant human FAM46C protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-67 aa of BC131726 Sequence: MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSRLEEAGIKVH Predict reactive species |
Full Name | family with sequence similarity 46, member C |
Calculated Molecular Weight | 391 aa, 45 kDa |
GenBank Accession Number | BC131726 |
Gene Symbol | FAM46C |
Gene ID (NCBI) | 54855 |
RRID | AB_2879863 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q5VWP2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
Species | Application | Title |
---|---|---|
Cancer Sci Biallelic loss of FAM46C triggers tumor growth with concomitant activation of Akt signaling in multiple myeloma cells.
|