Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, Jurkat cells, NIH/3T3 cells |
| Positive IHC detected in | rat colon tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 1 publications below |
Product Information
19849-1-AP targets FAM50A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13907 Product name: Recombinant human FAM50A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 76-154 aa of BC000028 Sequence: KQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKR Predict reactive species |
| Full Name | family with sequence similarity 50, member A |
| Calculated Molecular Weight | 325 aa, 39 kDa |
| Observed Molecular Weight | 40 kDa |
| GenBank Accession Number | BC000028 |
| Gene Symbol | FAM50A |
| Gene ID (NCBI) | 9130 |
| RRID | AB_10641032 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14320 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FAM50A belongs to the FAM50 family. It is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional factor.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FAM50A antibody 19849-1-AP | Download protocol |
| WB protocol for FAM50A antibody 19849-1-AP | Download protocol |
| IF protocol for FAM50A antibody 19849-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









