Tested Applications
Positive WB detected in | mouse brain tissue, mouse colon tissue, HeLa cells, rat brain tissue |
Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
Product Information
20760-1-AP targets FAM57B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14707 Product name: Recombinant human FAM57B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 46-140 aa of BC007892 Sequence: SVQAIMASTAGYIVSTSCKHIIDDQHWLSSAYTQFAVPYFIYDIYAMFLCHWHKHQVKGHGGDDGAARAPGSTWAIARGYLHKEFLMVLHHAAMV Predict reactive species |
Full Name | family with sequence similarity 57, member B |
Calculated Molecular Weight | 274 aa, 31 kDa |
Observed Molecular Weight | 31 kDa |
GenBank Accession Number | BC007892 |
Gene Symbol | FAM57B |
Gene ID (NCBI) | 83723 |
RRID | AB_10732598 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q71RH2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FAM57B antibody 20760-1-AP | Download protocol |
IHC protocol for FAM57B antibody 20760-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Danielle (Verified Customer) (12-16-2018) | This is the only antibody I've found that resolves FAM57B at the correct size. However, the antibody is not very clean with the SH-SY5Y cells and will show multiple bands.
|