Tested Applications
Positive WB detected in | human brain tissue, HepG2 cells |
Positive IHC detected in | human brain tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
20904-1-AP targets FAM71E2 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15027 Product name: Recombinant human FAM71E2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 74-197 aa of BC031875 Sequence: SLPGLVLPDILLIGQPAEDRDCSGLVLTRMIPLDLVHLCVHDLSAWRLKLRLVSGRQYYLALDAPDNEVGFLFHCWVRLINLLQEPAPTWTPRTTRTAPLDMPLAKAPASTWHLQDQPISRHAV Predict reactive species |
Full Name | family with sequence similarity 71, member E2 |
Calculated Molecular Weight | 302 aa, 34 kDa |
Observed Molecular Weight | 34 kDa |
GenBank Accession Number | BC031875 |
Gene Symbol | FAM71E2 |
Gene ID (NCBI) | 284418 |
RRID | AB_11183765 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8N5Q1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FAM71E2 antibody 20904-1-AP | Download protocol |
IHC protocol for FAM71E2 antibody 20904-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |