Tested Applications
Positive WB detected in | PC-3 cells, mouse liver tissue |
Positive IF/ICC detected in | PC-3 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
24286-1-AP targets FAM71F2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16874 Product name: Recombinant human FAM71F2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 179-300 aa of BC105730 Sequence: KFTHCLVPKMPTNSTETTPENSLLSSPQPSEPLVLLAAEQTSGSFSQLSGKPQLTADRNNDTAIEIDNCSSYKIPSPVASPINLNIPMRAALSHSLWEQEDWNEHLLQVHIASYLGEHFLGA Predict reactive species |
Full Name | family with sequence similarity 71, member F2 |
Calculated Molecular Weight | 309 aa, 35 kDa |
Observed Molecular Weight | 40-45 kDa |
GenBank Accession Number | BC105730 |
Gene Symbol | FAM71F2 |
Gene ID (NCBI) | 346653 |
RRID | AB_2879473 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q6NXP2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FAM71F2 antibody 24286-1-AP | Download protocol |
IF protocol for FAM71F2 antibody 24286-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |