Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue, rat skeletal muscle tissue |
| Positive IHC detected in | human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25192-1-AP targets FBP2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18245 Product name: Recombinant human FBP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 283-339 aa of BC113632 Sequence: NPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS Predict reactive species |
| Full Name | fructose-1,6-bisphosphatase 2 |
| Calculated Molecular Weight | 339 aa, 37 kDa |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | BC113632 |
| Gene Symbol | FBP2 |
| Gene ID (NCBI) | 8789 |
| RRID | AB_2879951 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00757 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FBP2, also named muscle FBP, belongs to the FBPase class 1 family. FBP2 is a ubiquitously expressed enzyme of glycogen synthesis from non-carbohydrates, e.g., lactate (glyconeogenesis). However, it also plays a variety of non-enzymatic functions. FBP2 is involved in the regulation of hypoxia-inducible factor 1 (Hif1 ) stability, cell cycle-dependent events, biogenesis of mitochondria, and protection of the organelles against high reactive oxygen species (ROS)- and high Ca2+-induced stress (PMID: 32962293, PMID: 35626746). The calculated molecular weight of FBP2 is 37 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FBP2 antibody 25192-1-AP | Download protocol |
| WB protocol for FBP2 antibody 25192-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Food Funct Free fatty acids induce the demethylation of the fructose 1,6-biphosphatase 2 gene promoter and potentiate its expression in hepatocytes. | ||
J Anim Sci Biotechnol Taurodeoxycholic, taurocholic, and glycocholic acids promote hepatic gluconeogenesis via TGR5 in dairy cows. | ||
Biomolecules Integrated Proteomic and Metabolomic Analysis of Muscle Atrophy Induced by Hindlimb Unloading. | ||
Sci Rep Identification of mouse soleus muscle proteins altered in response to changes in gravity loading | ||
FASEB J Overexpression of enhanced yellow fluorescent protein fused with Channelrhodopsin-2 causes contractile dysfunction in skeletal muscle |





