FBXL8 Polyclonal antibody

FBXL8 Polyclonal Antibody for IHC, IP, ELISA

Cat No. 16505-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IP, ELISA

FBL8, F-box and leucine-rich repeat protein 8, F-box protein FBL8, F-box/LRR-repeat protein 8

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IP detected inHCT 116 cells
Positive IHC detected inmouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16505-1-AP targets FBXL8 in IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9685

Product name: Recombinant human FBXL8 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-374 aa of BC014414

Sequence: MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCGAASQLRHLDLRRLSFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGPGSVLELLEACPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYAATLCALEVRAAASAELNAALEELAARCAALREVHCFCVVSHSVLDAFRAHCPRLRTYTLKLTREPHPWRPTLVA

Predict reactive species
Full Name F-box and leucine-rich repeat protein 8
Calculated Molecular Weight 374 aa, 41 kDa
Observed Molecular Weight41 kDa
GenBank Accession NumberBC014414
Gene Symbol FBXL8
Gene ID (NCBI) 55336
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96CD0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FBXL8 is a conserved F-box protein that belongs to the ubiquitin ligase complex. It plays a significant role in various cellular processes, including tumorigenesis and metastasis. In colorectal cancer, FBXL8 promotes liver metastasis and stem-cell-like features by mediating ubiquitination and degradation of TP53. Additionally, FBXL8 has been shown to inhibit lymphoma growth and hematopoietic malignancies by targeting specific substrates for degradation. In the context of cardiac fibrosis, FBXL8 inhibits post-myocardial infarction cardiac fibrosis by regulating the ubiquitination of key proteins (PMID: 36855778, PMID: 33122824, PMID: 38615011).

Protocols

Product Specific Protocols
IHC protocol for FBXL8 antibody 16505-1-APDownload protocol
IP protocol for FBXL8 antibody 16505-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...