Featured Product
KD/KO Validated

FDX1 Polyclonal antibody

FDX1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12592-1-AP

Publications (259)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

ADX, FDX, Ferredoxin-1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis using 12592-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 12592-1-AP (FDX1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 12592-1-AP
WB result of FDX1 antibody (12592-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FDX1 transfected HEK-293 cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 12592-1-AP
WB result of FDX1 antibody (12592-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FDX1 transfected HepG2 cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 12592-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 12592-1-AP (FDX1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 12592-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 12592-1-AP (FDX1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 12592-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 12592-1-AP (FDX1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 12592-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 12592-1-AP (FDX1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 12592-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 12592-1-AP (FDX1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary tumor using 12592-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 12592-1-AP (FDX1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary tumor using 12592-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 12592-1-AP (FDX1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 12592-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12592-1-AP (FDX1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 12592-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 12592-1-AP (FDX1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 12592-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 12592-1-AP (FDX1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 12592-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 12592-1-AP (FDX1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat adrenal gland using 12592-1-AP
Immunohistochemical analysis of paraffin-embedded rat adrenal gland tissue slide using 12592-1-AP (FDX1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 12592-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12592-1-AP (FDX1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 12592-1-AP
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using FDX1 antibody (12592-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FDX1 in ?

Overview

Tested Applications
Product Information
Publications (259)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	A549 cells, HEK-293 cells, HepG2 cells, PC-3 cells, mouse testis tissue
Positive IHC detected in	human kidney tissue, mouse kidney tissue, human ovary tumor tissue, human placenta tissue, human liver tissue, human colon cancer tissue, rat adrenal gland tissue, human kidney tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:4000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12592-1-AP targets FDX1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat, sheep
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag3301 Product name: Recombinant human FDX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC017063 Sequence: MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS Predict reactive species
Full Name	ferredoxin 1
Calculated Molecular Weight	184 aa, 19 kDa
Observed Molecular Weight	14 kDa
GenBank Accession Number	BC017063
Gene Symbol	FDX1
Gene ID (NCBI)	2230
RRID	AB_11182486
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P10109
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FDX1(Ferredoxin-1) is also named as ADX, FDX, YAH1, LOH11CR1D and belongs to the adrenodoxin/putidaredoxin family. It is a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to a terminal cytochrome P450 and it can only reduce mitochondrial CYP enzymes that are essential in adrenal steroidogenesis, bile acid formation, and vitamin D synthesis. The full length has a transit peptide of 60 amino acids.

Protocols

Product Specific Protocols
IF protocol for FDX1 antibody 12592-1-AP	Download protocol
IHC protocol for FDX1 antibody 12592-1-AP	Download protocol
WB protocol for FDX1 antibody 12592-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-FDX1 (Ferredoxin 1) antibody, catalog number 12592-1-AP, has accumulated 259 total citations. Citations appear in high-impact journals including Nature, Cancer Cell, Nature Communications, Science Advances, Advanced Materials, ACS Nano, Molecular Cell, Biomaterials, and Advanced Science. Research fields span cuproptosis mechanisms, cancer immunotherapy, ferroptosis, mitochondrial biology, copper homeostasis, nanomedicine therapeutics, cardiovascular disease, neurodegeneration, and inflammatory disorders.

Species	Application	Title
human	WB	Signal Transduct Target Ther Conductive coordination nanozyme prodrugs precisely trigger pyroptosis, cuproptosis and ferroptosis for in situ cancer vaccination Authors - Yuqiao Wang View Article
human	WB	Nature SLC25A39 is necessary for mitochondrial glutathione import in mammalian cells. Authors - Ying Wang View Article
mouse,human	WB,IHC	Cancer Cell Radiotherapy promotes cuproptosis and synergizes with cuproptosis inducers to overcome tumor radioresistance Authors - Guang Lei KD Validated View Article
human	WB	Imeta Clinical features and molecular landscape of cuproptosis signature-related molecular subtype in gastric cancer Authors - Wei Chong View Article
mouse	WB	Adv Mater Multifunctional Copper-Phenolic Nanopills Achieve Comprehensive Polyamines Depletion to Provoke Enhanced Pyroptosis and Cuproptosis for Cancer Immunotherapy Authors - Guoqing Zhu View Article
mouse	WB	Adv Mater One-Step Symbiosis of Bimetallic Peroxides Nanoparticles to Induce Ferroptosis/Cuproptosis and Activate cGAS-STING Pathway for Enhanced Tumor Immunotherapy Authors - Bin Liu View Article