Tested Applications
| Positive WB detected in | mouse brain tissue, Jurkat cells, rat brain tissue |
| Positive IHC detected in | human normal colon, human colon tissue, human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 7 publications below |
| IHC | See 1 publications below |
Product Information
10273-1-AP targets FKBP1A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0406 Product name: Recombinant human FKBP1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 6-108 aa of BC001925 Sequence: ETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE Predict reactive species |
| Full Name | FK506 binding protein 1A, 12kDa |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC001925 |
| Gene Symbol | FKBP1A |
| Gene ID (NCBI) | 2280 |
| RRID | AB_2231588 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62942 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FKBP1A(FK506-binding protein 1A) is also named as FKBP1, FKBP12 and belongs to the FKBP-type PPIase family.It keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand and catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FKBP1A antibody 10273-1-AP | Download protocol |
| WB protocol for FKBP1A antibody 10273-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Rep Sequencing of captive target transcripts identifies the network of regulated genes and functions of primate-specific miR-522. | ||
Food Chem TMT-based quantitative proteomic analysis of porcine muscle associated with postmortem meat quality. | ||
Cell Biol Toxicol Andrographolide ameliorates sepsis-induced acute liver injury by attenuating endoplasmic reticulum stress through the FKBP1A-mediated NOTCH1/AK2 pathway | ||
Oncotarget TGFBR-IDH1-Cav1 axis promotes TGF-β signalling in cancer-associated fibroblast. | ||
Mol Pharmacol FK506 Binding Protein 12 Modulates μ Opioid Receptor Phosphorylation and PKC{epsilon}-dependent Signaling by its Direct Interaction with the Receptor.
| ||
Int J Med Sci Integrated analysis of FKBP1A/SLC3A2 axis in everolimus inducing ferroptosis of breast cancer and anti-proliferation of T lymphocyte
|











