Use Able AI chat for product recommendations

Fibromodulin Monoclonal antibody

Fibromodulin Monoclonal Antibody for WB, ELISA

Cat No. 60108-2-Ig
Clone No.2B11D3

Host / Isotype

Mouse / IgG1

Reactivity

human, pig, rabbit

Applications

WB, ELISA

FMOD, Collagen-binding 59 kDa protein, FM, Keratan sulfate proteoglycan fibromodulin, KSPG fibromodulin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrabbit heart tissue, human testis tissue, pig heart tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60108-2-Ig targets Fibromodulin in WB, ELISA applications and shows reactivity with human, pig, rabbit samples.

Tested Reactivity human, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4030

Product name: Recombinant human FMOD protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-376 aa of BC035281

Sequence: MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCLRLASLIEI

Predict reactive species
Full Name fibromodulin
Calculated Molecular Weight 376 aa, 43 kDa
Observed Molecular Weight50-60kDa, 43 kDa
GenBank Accession NumberBC035281
Gene Symbol Fibromodulin
Gene ID (NCBI) 2331
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ06828
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fibromodulin (FMOD), an extracellular matrix protein, belongs to the small leucine-rich proteoglycan family. Fibromodulin is a collagen-binding protein present in many types of connective tissues, e.g. cartilage, tendon, skin, sclera and cornea (PMID: 2531085). It is involved in fibrillogenesis, cell adhesion, and cytokine activity modulation (PMID: 15741214). Fibromodulin may participate in the assembly of the extracellular matrix as it interacts with type I and type II collagen fibrils and inhibits fibrillogenesis in vitro. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix. The calculated molecular mass of fibromodulin is 43 kDa, extracellular fibromodulin appears as one single band of 59 kDa due to glycosylation (PMID: 2531085; 22138190).

Protocols

Product Specific Protocols
WB protocol for Fibromodulin antibody 60108-2-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...