Tested Applications
| Positive WB detected in | mouse liver tissue, mouse stomach tissue, mouse skeletal muscle tissue, rat liver tissue |
| Positive IHC detected in | mouse skeletal muscle tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 30 publications below |
| IHC | See 8 publications below |
| IF | See 4 publications below |
Product Information
23995-1-AP targets FNDC5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21195 Product name: Recombinant human FNDC5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 14-76 aa of BC062297 Sequence: SCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLR Predict reactive species |
| Full Name | fibronectin type III domain containing 5 |
| Calculated Molecular Weight | 212 aa, 24 kDa |
| Observed Molecular Weight | 25-30 kDa |
| GenBank Accession Number | BC062297 |
| Gene Symbol | FNDC5 |
| Gene ID (NCBI) | 252995 |
| RRID | AB_2879394 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NAU1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
fibronectin type III domain containing 5(FNDC5)encodes 23kDa protein, which is a membrane protein that is cleaved and secreted as a newly identified hormone, irisin. The exercise induces muscle FNDC5 expression. Exercise-induced FNDC5 gene expression in muscles was accompanied by a parallel increase in the concentration of circulating irisin, which in turn activates adipocyte thermogenic programs, leading to mitochondrial heat production and energy expenditure.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FNDC5 antibody 23995-1-AP | Download protocol |
| WB protocol for FNDC5 antibody 23995-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Clin Transl Med CRISPRa-based activation of Fgf21 and Fndc5 ameliorates obesity by promoting adipocytes browning | ||
Neuropathol Appl Neurobiol Irisin treatment lowers levels of phosphorylated tau in the hippocampus of pre-symptomatic female but not male htau mice. | ||
Aging (Albany NY) Vitellogenin 2 promotes muscle development and stimulates the browning of white fat | ||
J Am Heart Assoc Irisin Lowers Blood Pressure by Improvement of Endothelial Dysfunction via AMPK-Akt-eNOS-NO Pathway in the Spontaneously Hypertensive Rat. | ||
Biochim Biophys Acta Mol Basis Dis Irisin is induced in renal ischemia-reperfusion to protect against tubular cell injury via suppressing p53. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Mohammad (Verified Customer) (12-02-2019) | 1:600 in mice hippocampusworks well with no non-specific band
|









