• Featured Product
  • KD/KO Validated

FOLR1 Polyclonal antibody

FOLR1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 23355-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF/ICC, ELISA

Folate receptor alpha, folate receptor 1 (adult), Folate receptor 1, FBP, Adult folate-binding protein

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, JAR cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23355-1-AP targets FOLR1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, camelus bactrianus
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19959

Product name: Recombinant human FOLR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 55-93 aa of BC002947

Sequence: EQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMA

Predict reactive species
Full Name folate receptor 1 (adult)
Calculated Molecular Weight 257 aa, 30 kDa
Observed Molecular Weight 38 kDa
GenBank Accession NumberBC002947
Gene Symbol FOLR1
Gene ID (NCBI) 2348
RRIDAB_2879264
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP15328
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Folate receptor 1 (FOLR1), also known as folate receptor alpha or adult folate-binding protein (FBP), is a 38-kDa glycoprotein belonging to the folate receptor family (PMID:15094207; 23528302). The receptor binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. FOLR1 is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. FOLR1 expression is often limited to the apical surfaces of epithelium in the lung, kidney and choroid plexus but is differentially overexpressed in a variety of solid tumors such as ovarian cancer, non-small cell lung cancer, breast cancer, kidney cancer and high-grade osteosarcoma (PMID: 23528302; 23357463).

Protocols

Product Specific Protocols
WB protocol for FOLR1 antibody 23355-1-APDownload protocol
IHC protocol for FOLR1 antibody 23355-1-APDownload protocol
IF protocol for FOLR1 antibody 23355-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

ACS Nano

Synchronization of Nanoparticle Sensitization and Radiosensitizing Chemotherapy through Cell Cycle Arrest Achieving Ultralow X-ray Dose Delivery to Pancreatic Tumors.

Authors - Divinah Manoharan
human,ratWB

Adv Sci (Weinh)

Hierarchical Targeting Nanodrug with Holistic DNA Protection for Effective Treatment of Acute Kidney Injury

Authors - Qiaohui Chen
humanWB

J Am Chem Soc

Cancer Selective Target Degradation by Folate-Caged PROTACs.

Authors - Jing Liu
  • KD Validated
humanWB

ACS Appl Mater Interfaces

Design and Fabrication of Multifunctional Sericin Nanoparticles for Tumor Targeting and pH-Responsive Subcellular Delivery of Cancer Chemotherapy Drugs.

Authors - Lei Huang
humanWB

J Med Chem

Folate-Guided Protein Degradation by Immunomodulatory Imide Drug-Based Molecular Glues and Proteolysis Targeting Chimeras.

Authors - He Chen
  • KD Validated
humanWB

BMC Cancer

Cancer-associated fibroblasts induce sorafenib resistance of hepatocellular carcinoma cells through CXCL12/FOLR1

Authors - Jiali Zhao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Marvin (Verified Customer) (12-01-2022)

The antibody had non-specific staining of the cytosol of MDA-MB-231 cells while performing immunofluorescent analysis.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: Monolayer of MDA-MB-231 cells
FOLR1 Antibody Western Blot,Immunofluorescence validation (1:50 dilution) in Monolayer of MDA-MB-231 cells (Cat no:23355-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...