Tested Applications
| Positive WB detected in | Jurkat cells, A549 cells, LNCaP cells, MCF-7 cells, MDA-MB-453s cells, mouse heart tissue, mouse lung tissue, mouse testis tissue, PC-3 cells, Raji cells, Y79 cells |
| Positive IHC detected in | mouse embryo tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 3 publications below |
| IF | See 1 publications below |
Product Information
22051-1-AP targets FOXP1 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17045 Product name: Recombinant human FOXP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 349-457 aa of BC131720 Sequence: QLELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQGPSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQNQEF Predict reactive species |
| Full Name | forkhead box P1 |
| Calculated Molecular Weight | 677 aa, 75 kDa |
| Observed Molecular Weight | 50 kDa, 60-65 kDa, 85 kDa |
| GenBank Accession Number | BC131720 |
| Gene Symbol | FOXP1 |
| Gene ID (NCBI) | 27086 |
| RRID | AB_2878980 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H334 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FOXP1, also known as Mac-1-regulated forkhead, is a 677 amino acid protein, which forms homodimers and heterodimers with FOXP2 and FOXP4 (PubMed:25027557). Dimerization is required for DNA-binding. FOXP1 has an important function in neuronal development.9 Mutations of its gene, FOXP1, located on chromosome 3p14.1,7 can result in the development of autism spectrum disorder, intellectual disability, speech and language deficits as well as motor development delay. FOXP1 is also engaged in lung and esophagus morphogenesis, as well as in B-cell development.7,10 The widely researched role of FOXP1 in carcinogenesis is of great importance, although still unclear to some extent. FOXP1 exists some isoforms with MV 75-77 kDa, 65-67 kDa, 12 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for FOXP1 antibody 22051-1-AP | Download protocol |
| IHC protocol for FOXP1 antibody 22051-1-AP | Download protocol |
| WB protocol for FOXP1 antibody 22051-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int Immunopharmacol Long non-coding RNA NEAT1 exacerbates NLRP3-mediated pyroptosis in allergic rhinitis through regulating the PTBP1/FOXP1 cascade | ||
J Cell Mol Med LINC01116 promotes proliferation and migration of endometrial stromal cells by targeting FOXP1 via sponging miR-9-5p in endometriosis. | ||
bioRxiv Temporally-segregated dual functions for Gfi1 in the development of retinal direction-selectivity | ||
J Neurochem FOXP1 is a Transcription Factor for the Alzheimer's Disease Risk Gene SORL1
|



























