Tested Applications
| Positive WB detected in | fetal human brain tissue, mouse brain tissue |
| Positive IP detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21942-1-AP targets FOXR1 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16625 Product name: Recombinant human FOXR1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 58-181 aa of BC028191 Sequence: NPNIVYPPGKLEVSGRRKREDLTSTLPSSQPPQKEEDASCSEAAGVESLSQSSSKRSPPRKRFAFSPSTWELTEEEEAEDQEDSSSMALPSPHKRAPLQSRRLRQASSQAGRLWSRPPLNYFHL Predict reactive species |
| Full Name | forkhead box R1 |
| Calculated Molecular Weight | 292 aa, 33 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | BC028191 |
| Gene Symbol | FOXR1 |
| Gene ID (NCBI) | 283150 |
| RRID | AB_2878952 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6PIV2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FOXR1, also known as FOXN5 (forkhead box N5) or DLNB13, is a 292 amino acid protein that contains a fkh DNA-binding domain. The Genome-based tissue expression consortium indicate that FOXR1 is expressed in the human brain and reproductive organs.







