Featured Product
KD/KO Validated

Fascin Polyclonal antibody

Fascin Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Cat No. 14384-1-AP

Publications(20)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Synonyms

FSCN1, 55 kDa actin bundling protein, 55 kDa actin-bundling protein, FAN1, Fascin 1,Fascin

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF-PIF/ICCFC (Intra)

WB analysis using 14384-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 14384-1-AP (Fascin antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 14384-1-AP
WB result of Fascin antibody (14384-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Fascin transfected HeLa cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 14384-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 14384-1-AP (Fascin antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse thymus using 14384-1-AP
mouse thymus tissue were subjected to SDS PAGE followed by western blot with 14384-1-AP (Fascin Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 14384-1-AP
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 14384-1-AP (Fascin antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 14384-1-AP
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 14384-1-AP (Fascin antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 14384-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14384-1-AP (Fascin antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 14384-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14384-1-AP (Fascin antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse brain using 14384-1-AP
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using 14384-1-AP (Fascin antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse brain using 14384-1-AP
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using 14384-1-AP (Fascin antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of U-87 MG using 14384-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed U-87 MG cells using Fascin antibody (14384-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of SH-SY5Y using 14384-1-AP
1X10^6 SH-SY5Y cells were intracellularly stained with 0.2 ug Anti-Human Fascin (14384-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with 0.1% TritonX-100.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (20)
Protocols
Reviews (2)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells, mouse thymus tissue, K-562 cells, NIH/3T3 cells, SH-SY5Y cells, SK-N-SH cells
Positive IHC detected in	human tonsillitis tissue, human liver cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	mouse brain tissue
Positive IF/ICC detected in	U-87 MG cells
Positive FC (Intra) detected in	SH-SY5Y cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:2000-1:8000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)-P	IF-P : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14384-1-AP targets Fascin in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag5816 Product name: Recombinant human Fascin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-187 aa of BC000521 Sequence: MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYS Predict reactive species
Full Name	fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus)
Calculated Molecular Weight	55 kDa
Observed Molecular Weight	50-55 kDa
GenBank Accession Number	BC000521
Gene Symbol	Fascin
Gene ID (NCBI)	6624
ENSEMBL Gene ID	ENSG00000075618
RRID	AB_2106381
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q16658
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fascin is a highly conserved and ubiquitous actin cross-linking protein that has a major function in cell motility and adhesion. Fascin localizes to a number of highly dynamic cellular structures that require strong mechanical support which include stress fibers and cellular protrusions such as microvilli, microspikes and lamellipodia. Fascin is up-regulated in many human carcinomas. It's a marker for Reed-Sternberg cells in Hodgkin's disease; it is also a highly selective marker for dendritic cells of lymphoid tissues.

Protocols

Product Specific Protocols
FC protocol for Fascin antibody 14384-1-AP	Download protocol
IF protocol for Fascin antibody 14384-1-AP	Download protocol
IHC protocol for Fascin antibody 14384-1-AP	Download protocol
WB protocol for Fascin antibody 14384-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	WB	Clin Transl Med Parkin regulates IGF2BP3 through ubiquitination in the tumourigenesis of cervical cancer Authors - Xin Sun View Article
mouse	WB,IF	Ecotoxicol Environ Saf Prenatal Perfluorooctanoic Acid (PFOA) exposure causes reproductive toxicity by disrupting the formation of transzonal projections (TZPs) and down-regulating Wnt4/β-catenin signaling pathway in progeny Authors - Hua Du View Article
human	WB	Aging (Albany NY) Exosomal lncRNA LINC01711 facilitates metastasis of esophageal squamous cell carcinoma via the miR-326/FSCN1 axis. Authors - Mei-Ling Xu View Article
human	WB	Int J Biol Macromol Recombinant porcine NK-lysin inhibits the invasion of hepatocellular carcinoma cells in vitro. Authors - Ajab Khan View Article
human	WB	Exp Cell Res Downregulation of fascin in the first trimester placental villi is associated with early recurrent miscarriage. Authors - Jones Lamptey KD Validated View Article
human	WB	J Exp Clin Cancer Res The role of microRNA-133b and its target gene FSCN1 in gastric cancer. Authors - Lihua Guo View Article

Reviews

4.0 out of 5

Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

Sai Sindhura Balus (Verified Customer) (12-22-2025)	The antibody of fascin is very good Applications: Western Blot, Immunohistochemistry Primary Antibody Dilution: 1:1000
Ryan (Verified Customer) (01-24-2018)	Antigen retrieval NaCit 0.1M ph6 Applications: Immunohistochemistry, Primary Antibody Dilution: 1:100 Cell Tissue Type: Retina/Brain Fascin Antibody Immunohistochemistry, validation (1:100 dilution) in Retina/Brain (Cat no:14384-1-AP)