×
Use Able AI chat for product recommendations

FSCN3 Polyclonal antibody

FSCN3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13536-1-AP
Publications(1)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Fascin 3, Fascin-3, Testis fascin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Filter:
  • Western Blot (WB) analysis of various lysates using FSCN3 Polyclonal antibody (13536-1-AP)

    WB analysis using 13536-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 13536-1-AP (FSCN3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of PC-3 cells using FSCN3 Polyclonal antibody (13536-1-AP)

    WB analysis of PC-3 using 13536-1-AP

    PC-3 cells were subjected to SDS PAGE followed by western blot with 13536-1-AP (FSCN3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human prostate cancer tissue using FSCN3 Polyclonal antibody (13536-1-AP)

    IHC staining of human prostate cancer using 13536-1-AP

    Immunohistochemical analysis of paraffin-embedded human prostate cancer using 13536-1-AP (FSCN3 antibody) at dilution of 1:50 (under 10x lens).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human prostate cancer tissue using FSCN3 Polyclonal antibody (13536-1-AP)

    IHC staining of human prostate cancer using 13536-1-AP

    Immunohistochemical analysis of paraffin-embedded human prostate cancer using 13536-1-AP (FSCN3 antibody) at dilution of 1:50 (under 40x lens).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of PC-3 cells using FSCN3 Polyclonal antibody (13536-1-AP)

    IF Staining of PC-3 using 13536-1-AP

    Immunofluorescent analysis of (-20℃ Ethanol) fixed PC-3 cells using 13536-1-AP (FSCN3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of PC-3 cells using FSCN3 Polyclonal antibody (13536-1-AP)

    IF Staining of PC-3 using 13536-1-AP

    Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using FSCN3 antibody (13536-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Tested Applications

Positive WB detected inHeLa cells, PC-3 cells, LNCaP cells
Positive IHC detected inhuman prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inPC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13536-1-AP targets FSCN3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4459

Product name: Recombinant human FSCN3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 142-498 aa of BC035606

Sequence: LHVHVILYSPIHRCYARADPTMGRIWVDAAVPCLEECGFLLHFRDGCYHLETSTHHFLSHVDRLFSQPSSQTAFHMQVRPGGLVALCDGEGGMLYPQGTHLLLGMGCNPMRGEEWFILQHCPTWVSLRSKTGRFISVIYDGEVRAASERLNRMSLFQFECDSESPTVQLRSANGYYLSQRRHRAVMADGHPLESDTFFRMHWNCGRIILQSCRGRFLGIAPNSLLMANVILPGPNEEFGILFANRSFLVLRGRYGYVGSSSGHDLIQCNQDQPDRIHLLPCRPGIYHFQAQGGSFWSITSFGTFRPWGKFALNFCIELQGSNLLTVLAPNGFYMRADQSGTLLADSEDITRECIWEF

Predict reactive species
Full Name fascin homolog 3, actin-bundling protein, testicular (Strongylocentrotus purpuratus)
Calculated Molecular Weight 498 aa, 57 kDa
Observed Molecular Weight 57 kDa
GenBank Accession NumberBC035606
Gene Symbol FSCN3
Gene ID (NCBI) 29999
RRIDAB_2106517
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NQT6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for FSCN3 antibody 13536-1-APDownload protocol
IHC protocol for FSCN3 antibody 13536-1-APDownload protocol
WB protocol for FSCN3 antibody 13536-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Ecotoxicol Environ Saf

PFOA exposure decreases acrosome reaction and increases DNA oxidative damage by impairing the sperm head shaping in mice.

Authors - Chuan Wang
View Article
||
New chat

Able™

正在加载，请稍候...