Tested Applications
Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, SH-SY5Y cells, mouse brain tissue, rat brain tissue |
Positive IP detected in | K-562 cells |
Positive IHC detected in | mouse brain tissue, human ovary tumor tissue, rat brain tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse colon tissue, mouse liver tissue |
Positive IF-Fro detected in | rat brain tissue |
Positive IF/ICC detected in | HepG2 cells, HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
11570-1-AP targets FUS/TLS in WB, IHC, IF/ICC, IF-P, IF-Fro, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, chicken |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2150 Product name: Recombinant human FUS/TLS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 53-400 aa of BC026062 Sequence: SSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGG Predict reactive species |
Full Name | fusion (involved in t(12;16) in malignant liposarcoma) |
Calculated Molecular Weight | 75 kDa |
Observed Molecular Weight | 68-75 kDa |
GenBank Accession Number | BC026062 |
Gene Symbol | FUS/TLS |
Gene ID (NCBI) | 2521 |
RRID | AB_2247082 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P35637 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FUS (also named TLS and POMp75) belongs to the RRM TET family. FUS may play a role in the maintenance of genomic integrity; it binds both single-stranded and double-stranded DNA and promotes ATP-independent annealing of complementary single-stranded DNAs and D-loop formation in superhelical double-stranded DNA. FUS is also an RNA-binding protein, and its links to neurodegenerative disease proffer the intriguing possibility that altered RNA metabolism or RNA processing may underlie or contribute to neuron degeneration[PMID: 22640227]. FUS may be a cause of angiomatoid fibrous histiocytoma (AFH) and is implicated in certain forms of amyotrophic lateral sclerosis (ALS) and frontotemporal dementias (FTDs) such as frontotemporal lobar dementia with ubiquitin inclusions (FTLD-U)[PMID: 22640227]. This antibody is a rabbit polyclonal antibody raised against an internal region of human FUS. FUS was detected double bands of 68-74 kDa (PMID:31519807).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FUS/TLS antibody 11570-1-AP | Download protocol |
IHC protocol for FUS/TLS antibody 11570-1-AP | Download protocol |
IF protocol for FUS/TLS antibody 11570-1-AP | Download protocol |
IP protocol for FUS/TLS antibody 11570-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nature Mutations in UBQLN2 cause dominant X-linked juvenile and adult-onset ALS and ALS/dementia. | ||
Nat Med Antisense oligonucleotide silencing of FUS expression as a therapeutic approach in amyotrophic lateral sclerosis. | ||
Cell Nuclear-Import Receptors Reverse Aberrant Phase Transitions of RNA-Binding Proteins with Prion-like Domains. | ||
Cell Metab NEAT1 is essential for metabolic changes that promote breast cancer growth and metastasis. | ||
Nat Neurosci FUS-mediated regulation of acetylcholine receptor transcription at neuromuscular junctions is compromised in amyotrophic lateral sclerosis.
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Xiaochen (Verified Customer) (07-08-2024) | Sensitivie for IF and show image with good quelity.
![]() |
FH Xhuljana (Verified Customer) (03-01-2024) | Used in siRNA transfected C2C12 cells
![]() |
FH Zhongwen (Verified Customer) (09-25-2023) | I can find two bands in the target region. I am not sure which one is the target band.
![]() |
FH manohar (Verified Customer) (07-10-2023) | Nitrocellulose membrane is used with 5% milk as blocking and antibody diluted in 1% milk and incubated overnight.
|
FH Tatyana (Verified Customer) (05-14-2023) | ICC using 5% goat serum/PBST buffer, 2 hours at RT. Good specific nuclear signal.
![]() |
FH shashirekha (Verified Customer) (12-23-2020) | Used for immunopreciptation at 1:1000 dilution. Works very well
![]() |
FH H (Verified Customer) (04-06-2020) | The antibody worked well for HCT116 cell line. Nuclear cytosolic fractionation clearly showed that FUS is dominantly in nucleus, and sub-fraction is present in cytosol.
![]() |
FH Karthik (Verified Customer) (04-24-2019) | Magenta- FUSBlue- MAP2FUS staining consistent obtained with this antibody is consistent with literature
|
FH Yen-Chen (Verified Customer) (12-03-2018) |
|