Tested Applications
Positive IHC detected in | mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | H9C2 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 13 publications below |
IHC | See 3 publications below |
IF | See 2 publications below |
IP | See 1 publications below |
CoIP | See 1 publications below |
ChIP | See 1 publications below |
Product Information
12091-1-AP targets G0S2 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2731 Product name: Recombinant human G0S2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC009694 Sequence: METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS Predict reactive species |
Full Name | G0/G1switch 2 |
Calculated Molecular Weight | 11 kDa |
GenBank Accession Number | BC009694 |
Gene Symbol | G0S2 |
Gene ID (NCBI) | 50486 |
RRID | AB_2877824 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P27469 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
G0S2 is G0/G1 switch protein 2. It is an all trans- retinoic acid (RA) target gene. G0S2 promotes apoptosis by binding to BCL2, hence preventing the formation of protective BCL2-BAX heterodimers.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for G0S2 antibody 12091-1-AP | Download protocol |
IF protocol for G0S2 antibody 12091-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cancer Res Bcl-xL enforces a slow-cycling state necessary for survival in the nutrient-deprived microenvironment of pancreatic cancer. | ||
J Clin Endocrinol Metab Endurance exercise training up-regulates lipolytic proteins and reduces triglyceride content in skeletal muscle of obese subjects. | ||
Genomics MIN score predicts primary response to infliximab/adalimumab and vedolizumab therapy in patients with inflammatory bowel diseases. | ||
J Clin Endocrinol Metab Moderate-Intensity Exercise and High-Intensity Interval Training Affect Insulin Sensitivity Similarly in Obese Adults. | ||
Mol Metab G0/G1 Switch Gene 2 controls adipose triglyceride lipase activity and lipid metabolism in skeletal muscle.
| ||