Tested Applications
Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IHC | See 2 publications below |
Product Information
22169-1-AP targets G6PC in IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17839 Product name: Recombinant human G6PC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC130478 Sequence: MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIK Predict reactive species |
Full Name | glucose-6-phosphatase, catalytic subunit |
Calculated Molecular Weight | 357 aa, 40 kDa |
GenBank Accession Number | BC130478 |
Gene Symbol | G6PC |
Gene ID (NCBI) | 2538 |
RRID | AB_2879015 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P35575 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Glucose-6-phosphatase-α (G6PC) is a key enzyme in glucose homeostasis that catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the terminal step of gluconeogenesis and glycogenolysis. G6PC activity is restricted to the liver , the kidney cortex and the small intestine and confers on these three organs the capacity to release glucose into the systemic circulation (PMID: 21983240).The encoded enzyme is anchored to the ER by nine transmembrane helices with the amino (N)-terminus in the lumen and the carboxyl (C)-terminus in the cytoplasm (PMID: 15542400).
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for G6PC antibody 22169-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Mol Metab Disrupted Liver Oxidative Metabolism in Glycine N-Methyltransferase-Deficient Mice is Mitigated by Dietary Methionine Restriction. | ||
Front Pharmacol β-lapachone suppresses carcinogenesis of cervical cancer via interaction with AKT1 | ||
Mol Nutr Food Res Douchi Peptides Vy and Sfllr Improve Glucose Homeostasis and Gut Dysbacteriosis In High-Fat Diet-Induced Insulin Resistant Mice | ||
J Genet Genomics Functionalized Gadofullerene Ameliorates Impaired Glycolipid Metabolism in Type 2 Diabetic Mice. | ||
Endocrinology Aspirin Suppresses Hepatic Glucagon Signaling Through Decreasing Production of Thromboxane A2 | ||