Tested Applications
| Positive WB detected in | HeLa cells, mouse brain tissue, SH-SY5Y cells, Chloroquine treated HEK-293 cells |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22439-1-AP targets GABARAP in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18209 Product name: Recombinant human GABARAP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC106749 Sequence: MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL Predict reactive species |
| Full Name | GABA(A) receptor-associated protein |
| Calculated Molecular Weight | 117 aa, 14 kDa |
| Observed Molecular Weight | 19-21 kDa |
| GenBank Accession Number | BC106749 |
| Gene Symbol | GABARAP |
| Gene ID (NCBI) | 11337 |
| RRID | AB_2879106 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95166 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GABARAP antibody 22439-1-AP | Download protocol |
| WB protocol for GABARAP antibody 22439-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
What customers say
The single review for 22439-1-AP is a 5-star rating from Carly Garrison (November 2020). The reviewer tested the antibody using EDTA plasma on an antibody microarray and reported a positive result. No additional details on dilution, tissue/cell type, or specific performance notes were provided. Overall, the feedback is favorable, indicating the product performed well in the reviewer's application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Carly (Verified Customer) (11-17-2020) | Tested using EDTA plasma on an antibody microarray
|
