Tested Applications
| Positive WB detected in | mouse brain tissue, mouse skeletal muscle tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25899-1-AP targets GABRR1 in WB, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23165 Product name: Recombinant human GABRR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 19-78 aa of BC130344 Sequence: RMHWPGREVHEMSKKGSRPQRQRREVHEDAHKQVSPILRRSPDITKSPLTKSEQLLRIDD Predict reactive species |
| Full Name | gamma-aminobutyric acid (GABA) receptor, rho 1 |
| Calculated Molecular Weight | 479 aa, 56 kDa |
| Observed Molecular Weight | 50-56 kDa |
| GenBank Accession Number | BC130344 |
| Gene Symbol | GABRR1 |
| Gene ID (NCBI) | 2569 |
| RRID | AB_2880290 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P24046 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GABRR1 is a member of a family of ligand-gated chloride channels that are the major inhibitory neurotransmitter receptors in the central nervous system. GABRR1 acts as a rho-1 receptor of GABA, the major inhibitory neurotransmitter in the vertebrate brain, may play a role in retinal neurotransmission. And then, GABRR1 is highly expressed in the retina and in a lesser extent in brain, lung and thymus. There are 3 isoforms for GABRR1 produced by alternative splicing, with the molecular weights of 46 kDa, 53 kDa, 56 kDa, respectively.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for GABRR1 antibody 25899-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GABRR1 Polyclonal antibody (Cat# 25899-1-AP) has 3 total citations. These appear in Translational Psychiatry, Insect Science, and Biochemical and Biophysical Research Communications. The associated research fields include neural inflammation and glucocorticoid signaling in mice, parasitoid wasp egg maturation and host cellular immunity, and extraction methods for analyzing fragile intermolecular associations. Cited applications span WB, IF, IP, and CoIP.
| Species | Application | Title |
|---|---|---|
Transl Psychiatry Acute stress induces severe neural inflammation and overactivation of glucocorticoid signaling in interleukin-18-deficient mice | ||
Insect Sci Rho 1 participates in parasitoid wasp eggs maturation and host cellular immunity inhibition | ||
Biochem Biophys Res Commun Extraction method combining saponin and trehalose useful for analyzing fragile intermolecular association |
