Tested Applications
| Positive WB detected in | HEK-293 cells, mouse brain tissue, rat brain tissue, HeLa cells, SH-SY5Y cells |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 5 publications below |
| IF | See 1 publications below |
Product Information
25674-1-AP targets GGA1 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat, mouse samples.
| Tested Reactivity | human, rat, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22614 Product name: Recombinant human GGA1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 276-395 aa of BC044629 Sequence: ALGLSDPTPPSGPSLDGTGWNSFQSSDATEPPAPALAQAPSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVSPE Predict reactive species |
| Full Name | golgi associated, gamma adaptin ear containing, ARF binding protein 1 |
| Observed Molecular Weight | 70-72 kDa |
| GenBank Accession Number | BC044629 |
| Gene Symbol | GGA1 |
| Gene ID (NCBI) | 26088 |
| RRID | AB_2880188 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UJY5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GGA1 antibody 25674-1-AP | Download protocol |
| WB protocol for GGA1 antibody 25674-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Clin Invest Chromosomal 3q amplicon encodes essential regulators of secretory vesicles that drive secretory addiction in cancer | ||
Cell Rep Golgi retention and oncogenic KIT signaling via PLCγ2-PKD2-PI4KIIIβ activation in gastrointestinal stromal tumor cells
| ||
Environ Toxicol Total flavonoids of Rhizoma drynariae improves tendon-bone healing for anterior cruciate ligament reconstruction in mice and promotes the osteogenic differentiation of bone mesenchymal stem cells by the ERR1/2-Gga1-TGF-β/MAPK pathway | ||
J Biol Chem GGA1 interacts with the endosomal Na+/H+ exchanger NHE6 governing localization to the endosome compartment | ||
Sci Adv ER-export and ARFRP1/AP-1-dependent delivery of SARS-CoV-2 Envelope to lysosomes controls late stages of viral replication |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Cristian (Verified Customer) (04-17-2019) | Immunofluorescent analysis of (PFA 3%) fixed HeLa cells using 25674-1-AP (GGA1 antibody) at dilution of 1:500 and Alexa Fluor 594-conjugated Affinipure Goat Anti-Rabbit IgG (H+L)
![]() |










