Tested Applications
| Positive WB detected in | HeLa cells, A549 cells, MCF-7 cells, PC-3 cells, HepG2 cells, Jurkat cells |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IF | See 1 publications below |
Product Information
26466-1-AP targets GLE1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24208 Product name: Recombinant human GLE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC030012 Sequence: MPSEGRCWETLKALRSSDKGRLCYYRDWLLRREDVLEECMSLPKLSSYSGWVVEHVLPHMQENQPLSETSPSSTSASALDQPSFVPKSPDASSAFSPASPATPNGTKGKDESQHTESM Predict reactive species |
| Full Name | GLE1 RNA export mediator homolog (yeast) |
| Calculated Molecular Weight | 80 kDa |
| Observed Molecular Weight | 79-80 kDa |
| GenBank Accession Number | BC030012 |
| Gene Symbol | GLE1 |
| Gene ID (NCBI) | 2733 |
| RRID | AB_2880525 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q53GS7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GLE1 antibody 26466-1-AP | Download protocol |
| WB protocol for GLE1 antibody 26466-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Rashmi (Verified Customer) (09-25-2024) | Excellent Product
|









