GLRA2 Polyclonal antibody

GLRA2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 13831-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

GLR, GLRA2, glycine receptor, alpha 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPBMC cells, K-562 cells
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13831-1-AP targets GLRA2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4743

Product name: Recombinant human GLRA2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-255 aa of BC032864

Sequence: MNRQLVNILTALFAFFLETNHFRTAFCKDHDSRSGKQPSQTLSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTKHYNTGKFTCIEVKFHLERQMG

Predict reactive species
Full Name glycine receptor, alpha 2
Calculated Molecular Weight 452 aa, 52 kDa
Observed Molecular Weight 48 kDa
GenBank Accession NumberBC032864
Gene Symbol GLRA2
Gene ID (NCBI) 2742
RRIDAB_2877980
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP23416
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glycine is an inhibitory neurotransmitter in the central nervous system. The glycine receptor (GlyR) is a member of the nicotinic acetylcholine receptor of ligand-gated ion channels. This receptor has important roles in a variety of physiological processes, especially in mediating inhibitory neurotransmission in the spinal cord and brain stem. GlyR is a pentameric receptor comprised of alpha and beta subunits. Four alpha-subunits (GLRA1, GLRA2, GLRA3, GLRA4) and one beta-subunit (GLRB) of GlyR have been identified. (PMID: 11409700; 15383648)

Protocols

Product Specific Protocols
IHC protocol for GLRA2 antibody 13831-1-APDownload protocol
WB protocol for GLRA2 antibody 13831-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Chelsea (Verified Customer) (02-17-2023)

We transfected HEK Cells with Glycine Receptor Alpha 1-2-3 to validate the GlyRa2 antibody. However, we saw staining in all conditions, even non transfected HEK cells (which have been validated to not contain endogenous GlyRa2). Therefore, we assume that the GlyRa2 antibody is not specific and binds an aspecifiek endogenous molecule.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Transfected HEK Cells
Loading...
||
New chat Able
正在加载,请稍候...