Tested Applications
Positive WB detected in | Jurkat cells, K-562 cells |
Positive IP detected in | Jurkat cells |
Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IF | See 1 publications below |
Product Information
25917-1-AP targets GMIP in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag23239 Product name: Recombinant human GMIP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC126436 Sequence: MDAAEPGLPPGPEGRKRYSDIFRSLDNLEISLGNVTLEMLAGDPLLSEDPEPDKTPTATVTNEASCWSGPSPEGPVPLTGEELDLRLIRTK Predict reactive species |
Full Name | GEM interacting protein |
Observed Molecular Weight | 130 kDa |
GenBank Accession Number | BC126436 |
Gene Symbol | GMIP |
Gene ID (NCBI) | 51291 |
RRID | AB_2880295 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9P107 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GMIP (Gem-interacting protein) is a 970 amino acid protein that stimulates the GTPase activity of RhoA in vitro and in vivo. GMIP interacts with Gem through its N-terminus and has a Rho GTPase-activating protein domain at its C-terminus. The Rho family of GTP-binding proteins plays a role in the development of neuronal structure. GMIP is able to inhibit RhoA function, leading to Actin cytoskeletal reorganization in vivo.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GMIP antibody 25917-1-AP | Download protocol |
IHC protocol for GMIP antibody 25917-1-AP | Download protocol |
IP protocol for GMIP antibody 25917-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |