Tested Applications
Positive WB detected in | SW480 cells, mouse brain tissue |
Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:16000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 3 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
13780-1-AP targets GNG4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag4787 Product name: Recombinant human GNG4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-75 aa of BC022485 Sequence: MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKFFCTIL Predict reactive species |
Full Name | guanine nucleotide binding protein (G protein), gamma 4 |
Calculated Molecular Weight | 75 aa, 8 kDa |
Observed Molecular Weight | 8 kDa |
GenBank Accession Number | BC022485 |
Gene Symbol | GNG4 |
Gene ID (NCBI) | 2786 |
RRID | AB_2109909 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P50150 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GNG4 antibody 13780-1-AP | Download protocol |
IHC protocol for GNG4 antibody 13780-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun Unraveling the spatial organization and development of human thymocytes through integration of spatial transcriptomics and single-cell multi-omics profiling | ||
Br J Cancer G-protein subunit gamma-4 expression has potential for detection, prediction and therapeutic targeting in liver metastasis of gastric cancer.
| ||
Acta Pharm Sin B Engagement of N6-methyladenisine methylation of Gng4 mRNA in astrocyte dysfunction regulated by CircHECW2 | ||
Toxicology KCNJ15 inhibits chemical-induced lung carcinogenesis and progression through GNB1 mediated Hippo pathway |