Tested Applications
Positive WB detected in | mouse eye tissue |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
11884-1-AP targets GNGT1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2488 Product name: Recombinant human GNGT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-74 aa of BC029367 Sequence: MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS Predict reactive species |
Full Name | guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 |
Calculated Molecular Weight | 74 aa, 8 kDa |
Observed Molecular Weight | 8 kDa |
GenBank Accession Number | BC029367 |
Gene Symbol | GNGT1 |
Gene ID (NCBI) | 2792 |
RRID | AB_10858628 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P63211 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
G protein subunit gamma-T1(GNGT1) is encoded by the transducin gamma-subunit gene, which localized on huaman chromosome 7q21.3, participating in various transmembrane signaling systems. Particularly, GNGT1 gene is specific to retinal rod photoreceptors. Present polyclonal anti-GNGT1 antibody (11884-1-AP) is produced by immunizing rabbits with full-length chain of GNGT1 and dectects an 8 kDa band in mouse retinal tissue.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GNGT1 antibody 11884-1-AP | Download protocol |
IF protocol for GNGT1 antibody 11884-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |