Tested Applications
| Positive WB detected in | mouse ovary tissue, mouse testis tissue |
| Positive IHC detected in | human testis tissue, rat testis tissue, mouse testis tissue, human pituitary adenoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 1 publications below |
Product Information
22462-1-AP targets GNRHR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18005 Product name: Recombinant human GNRHR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 226-285 aa of BC113546 Sequence: IMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYV Predict reactive species |
| Full Name | GnRH receptor |
| Calculated Molecular Weight | 328 aa, 38 kDa |
| Observed Molecular Weight | 60 kDa, 50 kDa |
| GenBank Accession Number | BC113546 |
| Gene Symbol | GNRHR |
| Gene ID (NCBI) | 2798 |
| RRID | AB_2879109 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P30968 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GNRHR, also named GRHR, belongs to the G-protein coupled receptor 1 family. GNRHR is a receptor for GnRH that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). It mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system. Isoform2 of GNRHR may act as an inhibitor of GnRH-R signaling. Defects in GNRHR are a cause of idiopathic hypogonadotropic hypogonadism (IHH). Defects in GNRHR are a cause of fertile eunuch syndrome. The antibody only recognizes the isoform1 of GNRHR. The predicted unmodified molecular weight of the human GNRHR is ~38 kDa, the larger band (50-65 kDa) is likely to represent a glycosylated form of GNRHR.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GNRHR antibody 22462-1-AP | Download protocol |
| WB protocol for GNRHR antibody 22462-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |























