Filter: AllWBIHC

WB analysis of mouse spleen using 24366-1-AP
mouse spleen tissue were subjected to SDS PAGE followed by western blot with 24366-1-AP (GPATCH2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
WB analysis of mouse thymus using 24366-1-AP
mouse thymus tissue were subjected to SDS PAGE followed by western blot with 24366-1-AP (GPATCH2 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.
WB analysis of mouse kidney using 24366-1-AP
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 24366-1-AP (GPATCH2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
IHC staining of human testis using 24366-1-AP
Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24366-1-AP (GPATCH2 Antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human breast cancer using 24366-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24366-1-AP (GPATCH2 Antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human lung cancer using 24366-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 24366-1-AP (GPATCH2 Antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human lung cancer using 24366-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 24366-1-AP (GPATCH2 Antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human testis using 24366-1-AP
Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24366-1-AP (GPATCH2 Antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human breast cancer using 24366-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24366-1-AP (GPATCH2 Antibody) at dilution of 1:50 (under 10x lens).

GPATCH2 Polyclonal antibody

Name: GPATCH2 Polyclonal antibody
Brand: Proteintech
SKU: 24366-1-AP

GPATCH2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24366-1-AP

Publications(1)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

G patch domain containing 2, GPATC2, GPATCH2, RP11 361K17.1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse spleen tissue, mouse kidney tissue, mouse thymus tissue
Positive IHC detected in	human breast cancer tissue, human testis tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WB	See 1 publications below

Product Information

24366-1-AP targets GPATCH2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag21647 Product name: Recombinant human GPATCH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 290-376 aa of BC063474 Sequence: KESGGACGITGVVPWWEKEDPTELDKNVPDPVFESILTGSFPLMSHPSRRGFQARLSRLHGMSSKNIKKSGGTPTSMATNWTSEIPL Predict reactive species
Full Name	G patch domain containing 2
Calculated Molecular Weight	528 aa, 59 kDa
Observed Molecular Weight	65-70 kDa
GenBank Accession Number	BC063474
Gene Symbol	GPATCH2
Gene ID (NCBI)	55105
RRID	AB_2879508
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9NW75
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.