Tested Applications
| Positive WB detected in | HuH-7 cells |
| Positive IHC detected in | human hepatocellular carcinoma Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IHC | See 4 publications below |
Product Information
30021-1-AP targets Glypican 3 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32559 Product name: Recombinant human GPC3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 415-554 aa of BC035972 Sequence: VAENDTLCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHN Predict reactive species |
| Full Name | glypican 3 |
| Calculated Molecular Weight | 580 aa, 66 kDa |
| Observed Molecular Weight | 66 kDa |
| GenBank Accession Number | BC035972 |
| Gene Symbol | GPC3 |
| Gene ID (NCBI) | 2719 |
| RRID | AB_2935499 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P51654 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Glypicans (GPCs) are a family of glycosylphosphatidylinositol (GPI)-anchored heparan sulfate proteoglycans (HSPGs) that may play a role in the control of cell division and growth regulation. In mammals, there are six GPCs (GPC1 to GPC6), all of which have a similar core-protein size of approx. 60 kDa and the clustering of glycosaminoglycan attachment site near the C-terminus. They are tethered to the cell surface by GPI linkages, which can be cleaved by endogenous phospholipases, thus releasing the protein. Glypican 3 (GPC3) is highly expressed in many tissues during development and plays an important role in the regulation of embryonic growth (PMID: 22467855). Loss-of-function mutations of GPC3 result in the Simpson-Golabi-Behmel overgrowth syndrome (SGBS), and Gpc-3 null mice display developmental overgrowth (PMID: 8589713; 18477453). In hepatocellular carcinoma (HCC), the overexpression of glypican 3 has been demonstrated to be a reliable diagnostic indicator (PMID: 19212669; 22706665). The calculated molecular weight of native glypican 3 is 66 kDa, and glycinate forms of glypican 3 have higher molecular weights than 66 kDa (PMID: 12851874; 16024626; 19574424).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Glypican 3 antibody 30021-1-AP | Download protocol |
| WB protocol for Glypican 3 antibody 30021-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cancer Res METTL3-mediated m6A modification regulates the polycomb repressive complex 1 (PRC1) components BMI1 and RNF2 in hepatocellular carcinoma cells | ||
J Hazard Mater Diesel exhaust promoted diethylnitrosamine-induced hepatocarcinogenesis in mice | ||
Future Sci OA Obesity-induced gut microbiota transplantation promotes the occurrence and development of hepatocellular carcinoma. | ||
Metabol Open Deoxycholic Acid and Lipoteichoic Acid cooperatively drive macrophage M2/M1 polarization via TGR5/STAT3 and TLR2/NF-κB to fuel HCC progression in obesity. | ||
Cell Oncol (Dordr) Multi-omics profiling reveals that Scissor(+) epithelial cells regulate intrahepatic metastasis of HCC via remodeling the metastatic microenvironment. | ||
Mol Cancer Integrating single cell- and spatial- resolved transcriptomics unravels the inter-tumor heterogeneity and immunosuppressive landscape in HBV- and Clonorchis sinensis-associated hepatocellular carcinoma. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH HADI (Verified Customer) (11-06-2025) | works very good in westerblot.
|



