Tested Applications
Positive WB detected in | mouse brain tissue |
Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 2 publications below |
Product Information
25247-1-AP targets GPR103 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19048 Product name: Recombinant human QRFPR protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 229-356 aa of BC128133 Sequence: EYDDVTIKMIFAIVQIIGFSNSICNPIVYAFMNENFKKNVSSAVCYCIVNKTFSPAQRHGNSGITMMRKKAKFSLRENPVEETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSELAENSPLDSGH Predict reactive species |
Full Name | pyroglutamylated RFamide peptide receptor |
Calculated Molecular Weight | 431 aa, 49 kDa |
Observed Molecular Weight | 50 kDa |
GenBank Accession Number | BC128133 |
Gene Symbol | GPR103 |
Gene ID (NCBI) | 84109 |
RRID | AB_2879987 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96P65 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GPR103 antibody 25247-1-AP | Download protocol |
IHC protocol for GPR103 antibody 25247-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Neurochem N-glycosylation of the human neuropeptide QRFP receptor (QRFPR) is essential for ligand binding and receptor activation. | ||
J Clin Lab Anal The variations in human orphan G protein-coupled receptor QRFPR affect PI3K-AKT-mTOR signaling.
|