Product Information
25963-1-AP targets GPR120 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20718 Product name: Recombinant human GPR120 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 220-291 aa of BC101175 Sequence: GLVIVISYSKILQITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIMWSPIIITILLILIQN Predict reactive species |
| Full Name | G protein-coupled receptor 120 |
| Calculated Molecular Weight | 361 aa, 41 kDa |
| GenBank Accession Number | BC101175 |
| Gene Symbol | GPR120 |
| Gene ID (NCBI) | 338557 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q5NUL3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
