Tested Applications
| Positive WB detected in | PC-3 cells, Jurkat cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24299-1-AP targets GRAMD4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19140 Product name: Recombinant human GRAMD4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 479-578 aa of BC129837 Sequence: PTDYIRNGVLYVTENYLCFESSKSGSSKRNKVIKLVDITDIQKYKVLSVLPGSGMGIAVSTPSTQKPLVFGAMVHRDEAFETILSQYIKITSAAASGGDS Predict reactive species |
| Full Name | GRAM domain containing 4 |
| Calculated Molecular Weight | 578 aa, 66 kDa |
| Observed Molecular Weight | 56, 60 kDa |
| GenBank Accession Number | BC129837 |
| Gene Symbol | GRAMD4 |
| Gene ID (NCBI) | 23151 |
| RRID | AB_2879482 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6IC98 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GRAMD4 also termed as Death inducing protein is a 578 amino-acid protein, which contains 1 GRAM domain. GRAMD4 as a multi-pass membrane protein localizes in the Mitochondrion membrane. Overexpression of GRAMD4 results in a strong apoptotic response involving caspase-3 activation and cleavage of poly(ADP-ribose)-polymerase. GRAMD4 is expressed in lung and in primary lung squamous cell carcinoma (LSCC) and shows up-regulation in mitochondria by E2F-1 after addition of 4-hydroxytamoxifen. This evidence suggests that GRAMD4 may be a potential target for cancer therapies. Full-length GRAMD4 expresses a protein of 66 kDa, whereas the 255 bp-deletion mutant expresses a protein of 56 kDa (PMID: 21127500).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GRAMD4 antibody 24299-1-AP | Download protocol |
| IP protocol for GRAMD4 antibody 24299-1-AP | Download protocol |
| WB protocol for GRAMD4 antibody 24299-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Clin Transl Med GRAMD4 inhibits tumour metastasis by recruiting the E3 ligase ITCH to target TAK1 for degradation in hepatocellular carcinoma.
| ||
Cell Death Discov Knockdown of SUCLG2 inhibits glioblastoma proliferation and promotes apoptosis through LMNA acetylation and the mediation of H4K16la lactylation. |





