Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Glutamine Synthetase Monoclonal antibody

Glutamine Synthetase Monoclonal Antibody for WB, IHC, IF, ELISA

Cat No. 66323-1-Ig
Clone No.1D10G8

Host / Isotype

Mouse / IgG2b

Reactivity

human, pig, zebrafish and More (2)

Applications

WB, IHC, IF, ELISA

GLNS, GLUL, Glutamate ammonia ligase, Glutamate decarboxylase, Glutamine synthetase, GS, PIG43, PIG59

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, pig liver tissue, pig brain tissue
Positive IHC detected inhuman liver cancer tissue, human brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF detected inzebrafish retina, human brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)IF : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66323-1-Ig targets Glutamine Synthetase in WB, IHC, IF, ELISA applications and shows reactivity with human, pig, zebrafish samples.

Tested Reactivity human, pig, zebrafish
Cited Reactivityhuman, mouse, rat, zebrafish
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6309

Product name: Recombinant human Glutamine synthetase protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-373 aa of BC011700

Sequence: MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN

Predict reactive species
Full Name glutamate-ammonia ligase (glutamine synthetase)
Calculated Molecular Weight 374 aa, 42 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC011700
Gene Symbol Glutamine Synthetase
Gene ID (NCBI) 2752
RRIDAB_2881703
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP15104
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GLUL(Glutamine synthetase) is also named as GS,GLNS and belongs to the glutamine synthetase family.This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner By similarity. Essential for proliferation of fetal skin fibroblasts (PMID:18662667).Defects in GLUL are the cause of congenital systemic glutamine deficiency (CSGD).Organismal glutamine production is augmented secondary to an increase in the activity of glutamine synthetase in the lung and skeletal muscle(PMID:7630137). There are other bands with higher (66 kDa, 97 kDa) and lower (30 kDa)molecular weights also detected besides the 42 kDa band indicating the proteolysis of GLUL protein by the ubiquitin system(PMID:10091759).

Protocols

Product Specific Protocols
IF protocol for Glutamine Synthetase antibody 66323-1-IgDownload protocol
IHC protocol for Glutamine Synthetase antibody 66323-1-IgDownload protocol
WB protocol for Glutamine Synthetase antibody 66323-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

J Hepatol

OGDHL silencing promotes hepatocellular carcinoma by reprogramming glutamine metabolism.

Authors - Weiqi Dai
mouseIF

Acta Neuropathol

Selective vulnerability of tripartite synapses in amyotrophic lateral sclerosis.

Authors - Matthew J Broadhead

J Neurosci

C9ORF72 deficiency results in neurodegeneration in the zebrafish retina

Authors - Natalia Jaroszynska
zebrafishIF

Life Sci Alliance

Unique activities of two overlapping PAX6 retinal enhancers

Authors - Kirsty Uttley
humanWB

Front Pharmacol

A novel method for generating glutamatergic SH-SY5Y neuron-like cells utilizing B-27 supplement

Authors - Emily-Rose Martin
mouseIF

PLoS One

Excitatory to inhibitory synaptic ratios are unchanged at presymptomatic stages in multiple models of ALS

Authors - Calum Bonthron

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Calum (Verified Customer) (11-02-2021)

Glutamine synthetase (magenta) alongside alternative astrocyte marker GFAP (green) and DAPI (blue).

  • Applications: Immunofluorescence, Cell culture
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Primary Mouse Astrocytes
Glutamine Synthetase Antibody Immunofluorescence,Cell culture validation (1:500 dilution) in Primary Mouse Astrocytes (Cat no:66323-1-Ig)
FH

Ryan (Verified Customer) (02-27-2019)

Tris-HCL antigen retrieval ph=9.

  • Applications: Immunohistochemistry, Immunofluorescence,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Zebrafish retina (Muller glia) at 3dpf
Glutamine Synthetase Antibody Immunohistochemistry,Immunofluorescence, validation (1:100 dilution) in Zebrafish retina (Muller glia) at 3dpf (Cat no:66323-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...