Tested Applications
Positive WB detected in | human brain tissue, mouse kidney tissue |
Positive IHC detected in | human skin cancer tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 5 publications below |
IF | See 3 publications below |
Product Information
16441-1-AP targets Histone H2A.z in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, fish, oratosquilla oratoria |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag9762 Product name: Recombinant human Histone H2A.z protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC018002 Sequence: MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV Predict reactive species |
Full Name | H2A histone family, member Z |
Calculated Molecular Weight | 128 aa, 14 kDa |
Observed Molecular Weight | 14 kDa |
GenBank Accession Number | BC018002 |
Gene Symbol | Histone H2A.z |
Gene ID (NCBI) | 3015 |
RRID | AB_2115113 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P0C0S5 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Histone H2A.z antibody 16441-1-AP | Download protocol |
IHC protocol for Histone H2A.z antibody 16441-1-AP | Download protocol |
IF protocol for Histone H2A.z antibody 16441-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Biol Chem The chromatin remodeler protein Chd4 maintains embryonic stem cell identity by controlling pluripotency- and differentiation-associated genes.
| ||
Biomed Pharmacother Limonin enhances the radiosensitivity of nasopharyngeal carcinoma cells via attenuating Stat3-induced cell stemness. | ||
J Morphol Ultrastructure of spermiogenesis and the distribution of spermatozoal nuclear histones in the Japanese mantis shrimp, Oratosquilla oratoria (Crustacea: Stomatopoda). | ||
Front Oncol DJ-1 promotes osteosarcoma progression through activating CDK4/RB/E2F1 signaling pathway |