Tested Applications
| Positive WB detected in | mouse brain tissue, SH-SY5Y cells |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 9 publications below |
| IHC | See 3 publications below |
| IF | See 2 publications below |
Product Information
18370-1-AP targets HCRTR1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12269 Product name: Recombinant human HCRTR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 321-425 aa of BC074796 Sequence: KRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP Predict reactive species |
| Full Name | hypocretin (orexin) receptor 1 |
| Calculated Molecular Weight | 425 aa, 48 kDa |
| Observed Molecular Weight | 48-54 kDa |
| GenBank Accession Number | BC074796 |
| Gene Symbol | HCRTR1 |
| Gene ID (NCBI) | 3061 |
| RRID | AB_10858633 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43613 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The hypocretin receptor 1 (OX1R, also named HCRTR1) is a G protein-coupled receptor and is a critical participant in the regulation of motivated behavior (PMID:28971565). HCRTR1 is associated with the regulation of motivation, reward, and autonomic functions. HCRTR1 shows a selective binding affinity for HCRT1/orexin-A. Moreover, HCRTR1 and HCRTR2 share 64% sequence similarity in humans (PMID:34052813).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for HCRTR1 antibody 18370-1-AP | Download protocol |
| WB protocol for HCRTR1 antibody 18370-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Pharmacol The Ciji-Hua'ai-Baosheng II Formula Attenuates Chemotherapy-Induced Anorexia in Mice With H22 Hepatocellular Carcinoma. | ||
Brain Res Bull Aerobic training associated with an active lifestyle exerts a protective effect against oxidative damage in hypothalamus and liver: The involvement of energy metabolism. | ||
Drug Des Devel Ther Orexin-A Reverse Bone Mass Loss Induced by Chronic Intermittent Hypoxia Through OX1R-Nrf2/HIF-1α Pathway. | ||
Neuropeptides Transcranial pulsed current stimulation alleviates neuronal pyroptosis and neurological dysfunction following traumatic brain injury via the orexin-A/NLRP3 pathway | ||
Evid Based Complement Alternat Med Soporific Effect of Modified Suanzaoren Decoction and Its Effects on the Expression of CCK-8 and Orexin-A. | ||
Biochim Biophys Acta Mol Basis Dis Orexin-A/OX1R is involved in regulation of autophagy to promote cortisol secretion in adrenocortical cell |









