Tested Applications
Positive IP detected in | K-562 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 6 publications below |
IHC | See 1 publications below |
IP | See 1 publications below |
CoIP | See 1 publications below |
Product Information
26207-1-AP targets HDAC7 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24396 Product name: Recombinant human HDAC7 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 447-530 aa of BC006453 Sequence: EEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQRLASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL Predict reactive species |
Full Name | histone deacetylase 7 |
Calculated Molecular Weight | 103 kDa |
Observed Molecular Weight | 102 kDa |
GenBank Accession Number | BC006453 |
Gene Symbol | HDAC7 |
Gene ID (NCBI) | 51564 |
RRID | AB_2880426 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8WUI4 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IP protocol for HDAC7 antibody 26207-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Int J Biol Sci Discovery of a novel HDACi structure that inhibits the proliferation of ovarian cancer cells in vivo and in vitro. | ||
J Exp Clin Cancer Res HDAC7 promotes NSCLC proliferation and metastasis via stabilization by deubiquitinase USP10 and activation of β-catenin-FGF18 pathway.
| ||
Cell Death Dis AZGP1 activation by lenvatinib suppresses intrahepatic cholangiocarcinoma epithelial-mesenchymal transition through the TGF-β1/Smad3 pathway | ||
Commun Biol Interplay between acetylation and ubiquitination controls PSAT1 protein stability in lung adenocarcinoma | ||
Int J Biol Sci DNMT3a promotes LUAD cell proliferation and metastasis by activating the HDAC7 signalling pathway
|