Tested Applications
Positive WB detected in | HeLa cells |
Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
26635-1-AP targets HELZ in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24326 Product name: Recombinant human HELZ protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC130582 Sequence: MEDRRAEKSCEQACESLKRQDYEMALKHCTEALLSLGQYSMADFTGPCPLEIERIKIESLLYRIASFLQLKNYMQADEDCRHVLGEGLAKGEDAFRAVLCCM Predict reactive species |
Full Name | helicase with zinc finger |
Calculated Molecular Weight | 1942 aa, 219 kDa |
Observed Molecular Weight | 200 kDa |
GenBank Accession Number | BC130582 |
Gene Symbol | HELZ |
Gene ID (NCBI) | 9931 |
RRID | AB_2880584 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P42694 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for HELZ antibody 26635-1-AP | Download protocol |
IHC protocol for HELZ antibody 26635-1-AP | Download protocol |
IF protocol for HELZ antibody 26635-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |