Tested Applications
Positive WB detected in | human spleen tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
18341-1-AP targets HIST1H4F in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag13113 Product name: Recombinant human HIST1H4F protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-103 aa of BC093763 Sequence: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG Predict reactive species |
Full Name | histone cluster 1, H4f |
Calculated Molecular Weight | 103 aa, 11 kDa |
Observed Molecular Weight | 11 kDa |
GenBank Accession Number | BC093763 |
Gene Symbol | HIST1H4F |
Gene ID (NCBI) | 8361 |
RRID | AB_2878533 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P62805 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for HIST1H4F antibody 18341-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |