HLA-DMA Polyclonal antibody

HLA-DMA Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11838-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

D6S222E, DMA, DMA protein, DMA protein MHC class II antigen Major histocompatibility complex, class II, DM alpha cDNA FLJ75740, highly similar to Homo sapiens major histocompatibility complex, class II, DM alpha, hCG_2001572

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat spleen tissue, human liver tissue
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11838-1-AP targets HLA-DMA in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2452

Product name: Recombinant human HLA-DMA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 21-261 aa of BC026279

Sequence: LPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLGVLGIIVGIVLIIYFRKPCSGD

Predict reactive species
Full Name major histocompatibility complex, class II, DM alpha
Calculated Molecular Weight 261 aa, 29 kDa
Observed Molecular Weight 55-60 kDa
GenBank Accession NumberBC026279
Gene Symbol HLA-DMA
Gene ID (NCBI) 3108
RRIDAB_874186
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP28067
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I (HLA-A, B and C) and class II (HLA-D). The class II molecules are composed of two non-covalently associated alpha and beta chains. HLA-DMA and HLA-DMB form a functional heterodimer that is critical in the pathway of class II antigen presentation. HLA-DM plays a critical role in catalyzing the release of Class II HLA-associated invariant chain-derived peptides (CLIP) from newly synthesized class II HLA molecules and freeing the peptide binding site for acquisition of antigenic peptides. This antibody recognizes the 33kd HLA-DMA and the 50-60kd dimer in Western blotting.

Loading...
||
New chat

Able

正在加载,请稍候...