Tested Applications
| Positive WB detected in | HEK-293 cells, mouse liver tissue, mouse kidney tissue, U2OS cells |
| Positive IHC detected in | human hepatocirrhosis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 4 publications below |
| IHC | See 3 publications below |
| IF | See 1 publications below |
Product Information
20416-1-AP targets SPP in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14158 Product name: Recombinant human SPP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 111-220 aa of BC008938 Sequence: VLGILALSHTISPFMNKFFPASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDV Predict reactive species |
| Full Name | histocompatibility (minor) 13 |
| Calculated Molecular Weight | 377 aa, 41 kDa |
| Observed Molecular Weight | 45 kDa, 100 kDa |
| GenBank Accession Number | BC008938 |
| Gene Symbol | HM13/SPP |
| Gene ID (NCBI) | 81502 |
| RRID | AB_10665421 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TCT9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SPP antibody 20416-1-AP | Download protocol |
| WB protocol for SPP antibody 20416-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Cell Sci Topology surveillance of the lanosterol demethylase CYP51A1 by Signal Peptide Peptidase
| ||
PLoS One Visualizing active enzyme complexes using a photoreactive inhibitor for proximity ligation--application on γ-secretase. | ||
Cell Death Dis Histocompatibility Minor 13 (HM13), targeted by miR-760, exerts oncogenic role in breast cancer by suppressing autophagy and activating PI3K-AKT-mTOR pathway
| ||
Front Pharmacol Pan-cancer analysis suggests histocompatibility minor 13 is an unfavorable prognostic biomarker promoting cell proliferation, migration, and invasion in hepatocellular carcinoma
| ||
Tissue Cell The role of HM13 expression and its relationship to PI3K/Akt and p53 signaling pathways in colorectal cancer | ||
J Exp Clin Cancer Res miRNA-503 inhibition exerts anticancer effects and reduces tumor growth in mesothelioma |











