Tested Applications
Positive WB detected in | HepG2 cells, HeLa cells |
Positive IHC detected in | human kidney tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 7 publications below |
IHC | See 1 publications below |
Product Information
11695-1-AP targets HMGN1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2315 Product name: Recombinant human HMGN1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC023984 Sequence: MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD Predict reactive species |
Full Name | high-mobility group nucleosome binding domain 1 |
Calculated Molecular Weight | 100 aa, 11 kDa |
Observed Molecular Weight | 17 kDa |
GenBank Accession Number | BC023984 |
Gene Symbol | HMGN1 |
Gene ID (NCBI) | 3150 |
RRID | AB_2248375 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P05114 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HMGN1 (high-mobility group nucleosome-binding protein 1) is a member of the HMG superfamily of nonhistone chromatin-binding proteins, which which regulate chromatin structure and gene transcription. It binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. It may participate in the process which maintains transcribable genes in an unique chromatin conformation, and inhibit the phosphorylation of nucleosomal histones H3 and H2A by RPS6KA5/MSK1 and RPS6KA3/RSK2 expressed abundantly
Protocols
Product Specific Protocols | |
---|---|
WB protocol for HMGN1 antibody 11695-1-AP | Download protocol |
IHC protocol for HMGN1 antibody 11695-1-AP | Download protocol |
IF protocol for HMGN1 antibody 11695-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Exp Med High-mobility group nucleosome-binding protein 1 acts as an alarmin and is critical for lipopolysaccharide-induced immune responses. | ||
Nat Commun Alarmin-painted exosomes elicit persistent antitumor immunity in large established tumors in mice. | ||
Cancer Res The alarmin HMGN1 contributes to anti-tumor immunity and is a potent immunoadjuvant. | ||
Theranostics Alarmin augments the antitumor immunity of lentiviral vaccine in ectopic, orthotopic and autochthonous hepatocellular carcinoma mice. | ||
J Proteomics Proteomic profiling of human decidual immune proteins during Toxoplasma gondii infection. | ||
PeerJ PM2.5 exposure aggravates kidney damage by facilitating the lipid metabolism disorder in diabetic mice |