Tested Applications
| Positive WB detected in | Jurkat cells, HeLa cells, HepG2 cells, HL-60 cells, K-562 cells |
| Positive IHC detected in | human prostate cancer tissue, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| ELISA | See 1 publications below |
Product Information
10953-1-AP targets HMGN2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1401 Product name: Recombinant human HMGN2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC014644 Sequence: MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK Predict reactive species |
| Full Name | high-mobility group nucleosomal binding domain 2 |
| Calculated Molecular Weight | 9 aa, 3 kDa |
| Observed Molecular Weight | 18-20 kDa |
| GenBank Accession Number | BC014644 |
| Gene Symbol | HMGN2 |
| Gene ID (NCBI) | 3151 |
| RRID | AB_2118482 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05204 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HMGN2 is a highly conserved nucleosomal protein which may involve in unfolding higher-order chromatin structure and facilitating the transcriptional activation of mammalian genes. It is the most abundant, ubiquitous and evolutionarily conserved nonhistione proteins found in the nuclei of higher eukaryotes. It binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HMGN2 antibody 10953-1-AP | Download protocol |
| IHC protocol for HMGN2 antibody 10953-1-AP | Download protocol |
| WB protocol for HMGN2 antibody 10953-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Ecotoxicol Environ Saf Proteomic analysis reveals that cigarette smoke exposure diminishes ovarian reserve in mice by disrupting the CREB1-mediated ovarian granulosa cell proliferation-apoptosis balance | ||
Chem Sci A constitutional isomer selective chemical proteomic strategy for system-wide profiling of protein lysine 5-hydroxylation | ||
J Proteomics DIA-based quantitative proteomic analysis of porcine endometrium in the peri-implantation phase | ||
Exp Cell Res Inhibition of HMGN2 SUMOylation ameliorates atherosclerosis by activating PAX5 expression to induce macrophage M2 polarization |



















