Tested Applications
Positive WB detected in | HeLa cells |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
11686-1-AP targets HMGN4 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2298 Product name: Recombinant human HMGN4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC001282 Sequence: MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK Predict reactive species |
Full Name | high mobility group nucleosomal binding domain 4 |
Calculated Molecular Weight | 90 aa, 10 kDa |
Observed Molecular Weight | 15 kDa |
GenBank Accession Number | BC001282 |
Gene Symbol | HMGN4 |
Gene ID (NCBI) | 10473 |
RRID | AB_2118489 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O00479 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HMGN4, also named as High mobility group nucleosome-binding domain-containing protein 4, is a 90 amino acid protein, which belongs to the HMGN family. HMGN4 as a DNA-binding protein localizes in the nucleus. The calculated molecular weight of HMGN4 is 10 kDa, but the modified HMGN4 protein is about 15 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for HMGN4 antibody 11686-1-AP | Download protocol |
IF protocol for HMGN4 antibody 11686-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |