Tested Applications
Positive WB detected in | HepG2 cells, C6 cells, Jurkat cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
25044-1-AP targets HOXA2 in WB, ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19224 Product name: Recombinant human HOXA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 256-340 aa of BC130571 Sequence: LSQQQAPNGHNGDSQSFPVSPLTSNEKNLKHFQHQSPTVPNCLSTMGQNCGAGLNNDSPEALEVPSLQDFSVFSTDSCLQLSDAV Predict reactive species |
Full Name | homeobox A2 |
Calculated Molecular Weight | 376 aa, 41 kDa |
Observed Molecular Weight | 41-43 kDa |
GenBank Accession Number | BC130571 |
Gene Symbol | HOXA2 |
Gene ID (NCBI) | 3199 |
RRID | AB_2879868 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O43364 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HOXA2, also named as Homeobox protein Hox-A2, is a 376 amino acid protein, which contains 1 homeobox DNA-binding domain and belongs to the Antp homeobox family. HOXA2 localizes in the nucleus and hsa an association with Microtia, hearing impairment, and cleft palate. HOXA2 as a sequence-specific transcription factor is part of a developmental regulatory system, which provides cells with specific positional identities on the anterior-posterior axis.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for HOXA2 antibody 25044-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |